PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN37021.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 571aa    MW: 63150 Da    PI: 6.3772
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN37021.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox261.6e-084905281854
                 HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 +F++  ++yp+ +e+  LA k gLt +qV++WF N R +
  KHN37021.1 490 MFQNflHPYPKDAEKHLLAVKSGLTRSQVSNWFINARVR 528
                 5887779******************************88 PP

2BELL62.68.4e-21364429470
        BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiae 70 
                 + ++ k++Ll ll+ Vd+ Y+q+ ++++tv+s+F+a+++l++ ++++++Al++iS  ++ L+++i++
  KHN37021.1 364 ATESNKSQLLMLLQLVDNGYSQCLDEIHTVVSAFHAATELDP-HMHAHFALQTISLLYKDLRERISN 429
                 56889*************************************.**********************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.2E-20285429IPR006563POX domain
PfamPF075269.2E-24291428IPR006563POX domain
PROSITE profilePS5007111.046469532IPR001356Homeobox domain
CDDcd000861.04E-10472533No hitNo description
SMARTSM003892.1E-5472536IPR001356Homeobox domain
SuperFamilySSF466893.72E-15474541IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-25475538IPR009057Homeodomain-like
PfamPF059209.1E-15489528IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 571 aa     Download sequence    Send to blast
MENNMYSARL DMAGRNSTGI DEIARHLAPK PLIHCYSFDL NNQNHIINGI PVLAGEQGEP  60
ANDVHVEGCF LNPASIADSN SFVTSQGKTI VGDASNQINN NDFQEHLVGG RPIASASLSA  120
ARIGLQANLE SSEALPYSMC SLEALGPYLF NNWQGTSNPL PATFGDHHHA YDELSSIGKW  180
NVNKILRAPE ADGTEILAYS SIGSLVQNGW TSSNVANLAN FAYNSPHCSN ELSLSLARSP  240
QTTGQCSEMS CSGASHSMNG TRSGLEQSSC SSKELCMRLG SNKHVQFSSA ILGSRFLVGI  300
QEILAQIATY SFENVEQINC SAAGVRAGGD KSASAFTPKR TVENNQNASM FGAHVEESPL  360
EGLATESNKS QLLMLLQLVD NGYSQCLDEI HTVVSAFHAA TELDPHMHAH FALQTISLLY  420
KDLRERISNC ILAMGPDFNS LCSEEEKEWS LETSFIQKQW ALQQLKRKDQ LWRPQRGLPE  480
RSVSVLRTWM FQNFLHPYPK DAEKHLLAVK SGLTRSQVSN WFINARVRLW KPMIEEMYAE  540
MSRRKACRNE EGMEITQRTR ISMKNQMLNI N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A2e-14478536563Homeobox protein Meis2
4xrm_B2e-14478536563Homeobox protein Meis2
5bng_A2e-14478536159Homeobox protein Meis2
5bng_B2e-14478536159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150360.0AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003549357.10.0PREDICTED: homeobox protein ATH1-like
RefseqXP_006601241.10.0PREDICTED: homeobox protein ATH1-like
RefseqXP_006601242.10.0PREDICTED: homeobox protein ATH1-like
RefseqXP_006601243.10.0PREDICTED: homeobox protein ATH1-like
SwissprotP487311e-102ATH1_ARATH; Homeobox protein ATH1
TrEMBLA0A0B2RRD50.0A0A0B2RRD5_GLYSO; Homeobox protein ATH1
TrEMBLK7MNH90.0K7MNH9_SOYBN; Uncharacterized protein
STRINGGLYMA17G34811.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59393249
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.11e-103homeobox gene 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]